What Is 3354 X 5 +339


Thanks

Answers

Answer 1
The asnwer is 17,109

Related Questions

In ASL, the correct order to sign the words "Hi, how are you?" is "Hi, you how is?"

Answers

Answer:

Technically, no.

Explanation:

In ASL, you sign "Hi, how are you?" by using the signs, "Hi", "How", and "you". So it would be "Hi, How you?

Should the US provide legal residency status to Dreamers?

Topic


Evidence


Description

Answers

The United States should provide legal residency status to Dreamers. Dreamers are immigrants who were brought to the United States as children. They have lived in the United States for many years, and consider themselves to be American. Dreamers have contributed to the United States in many ways, and their deportation would be a loss to the country.The United States has a history of providing legal status to immigrants who have made significant contributions to the country. Dreamers have made significant contributions to the United States, and their deportation would be a loss to the country. The United States should provide legal status to Dreamers in order to allow them to continue to contribute to the country.

What do you mean by legal residency?

Legal residency is a status granted to a person who is not a citizen of the country in which they live, but who has been given permission to live and work there.

To learn more abouy legal residency

https://brainly.com/question/1657374

#SPJ13

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

If you wanted too find the jet stream where would you go

Answers

Answer:i honestly don’t know

Explanation:

Answer:

i met u in califonya you said you loved him in gorgia  your herat is frozen over in supernova

Explanation:

Which statement best describes a situation in which scientists would have confidence in a scientific theory?

Answers

Answer:

Many tests have been done, and all of the results support the theory.

Explanation:

"A scientific theory is a well-substantiated explanation of some aspect of the natural world, based on a body of facts that have been repeatedly confirmed through observation and experimentation.

joe is buying apples and persimmons at the grocery store. Each apple costs $0.99 and each persimmon costs $0.79 if joe has $10 which of the following inequalities describes x, the number of apples and y the number of persimmons that he can buy

Answers

Answer:10 apples

Explanation:if its 10 apples 1 apple is 99 cent so you see this is a trick question but it is really 10 apples. your welcome

upon completion of a program at a vocational school, students earn a

Answers

Answer:

The anser would be certifacate or licence :)

Explanation:

Other Questions
Click here to view a list of the common polyatomic ions. what is the formula for ammonium sulfate? nh4so4 na2so3 (nh4)2so4 na2so4 Which list shows the absolute values in order from greatest to least select each correct answer. A: | 11 7/10 |, | 11 3/5 |, | 10 3/10 | B: | -3 1/3 |, | -3 2/3 |, | 2 2/3 | C: | -1 5/6 |, | 1 7/12 |, | 1 5/12 | D: | -6 5/7 |, | -6 3/7 |, | 5 2/7 | Please help I will give 100! 1. Juan bought fruit from the grocery store. The variables below define his purchase. Juan's bananas cost half as much as apples. Which equations can be used to model his purchase? Select each correct equation.* a = the number of apples he bought b = the number of bananas he bought x= the cost of an apple in dollars y= the cost of a banana in dollars A- a= 1/2 bb- y=1/2 xc- a=2bd- x=2ye- y=2af- b=1/2 x Does cultural refinement alone make a person civilized? Why or why not? Amplitude, period, and phase shift of sine and cosine functions 102,410,000,000,000,000,000,000,000 in scientific notation round to two digits after the decimal Simplify by combining like terms. 9x + 6 - 4x - 2x + 1 - 15 Need help with my math yall please?? In order for the people to take a fresh look at its brand, the american red cross used a ________ strategy. 7. Explain It Draw a net for a triangular pyramid. Explain how you know your dagram is correct. Will mark as brainlistWhich of the following best represents R= A - B ? Please help, its due soon! a receipt issued at the time of application upon the payment of premium that provides coverage effective as of the date of the application or medical exam, as long as the policy is issued as applied, is referred to as a: Use the following two points to answer parts a -c . (2, 3) , (- 1, - 6) a. Find the slope of the line passing through the two pointsb . Write an equation of a line passing through the two points in point slope form . c . Rewrite the equation of the line in slope -intercept form . Write an equation in standard form of the line that passes through the given points.7. (-3, 2); m = 1 a state government establishes an investment pool and invites local governments to participate. it is not governed by a formal trust agreement. which fund of the state government would report balances contributed by the local governments? How many liters of NH3, at STP, will react with 5.3 g. O2 to form NO3 and water? 4NH3 (g) + 9O2 (g) > 4NO3 + 6H2O (g) 4. AABC = ADBC by SSS. Select one set of corresponding parts that could be marked congruent by CPCTC.B.A11CDO CBDAO ZA ZDOZCZ ZBO ACBC A knight is a vassal to a lord 17. In a population of snoopets on the island of Moz, female snoopets with fuzzy heads had an average of 7.2 offspring per season, while female snoopets with bald heads had an average of 7.9 offspring per season. What is the minimum effective population size that will allow natural selection to overcome drift for the hairy head allele? wich time of line are shown in the figure