Answer:?
There are 44 people taking a trip in some small vans.
Each van holds 8 people. How many vans will they need?
Make a drawing for this problem that would explain

Answers

Answer 1

Answer:

They will need 6 vans to hold all 44 people.

Step-by-step explanation:

1 bus holds : 8

2 bus holds : 16

3 bus holds : 24

4 bus holds : 32

5 bus holds : 40

6 bus holds : 48 (4 extra seats)


Related Questions

4. If triangle ABC has the following measurements, find the measure of side c:
a = 5
B = 7
C = 42 degrees

Answers

Using cosine rule, the measure of side c is calculated as: 4.688

How to use the cosine rule?

In trigonometry, the Cosine Rule says that the square of the length of any side of a given triangle is equal to the sum of the squares of the length of the other sides minus twice the product of the other two sides multiplied by the cosine of angle included between them.

We are given the parameters as:

a = 5

B = 7

C = 42 degrees

Using cosine rule, we have:

c = √(a² + b² - 2ab cos C)

c = √(5² + 7² - 2(5 * 7) cos 42)

c = √(25 + 49 - 52.02)

c = √21.98

c = 4.688

Read more about Cosine Rule at: https://brainly.com/question/4372174

#SPJ1

Hector deposits $150,000 into an account earning 3.6% simple interest annually. Find the maturation value (final amount) of the account after 5 years.

Answers

simple interest

1 year: [tex]3.6\% \cdot 150,000 = \dfrac{3.6}{100} \cdot 150,000 = 5,400[/tex]

5 years: [tex]5,400(5) = 27,000[/tex]

the maturation value:

[tex]150,000 + 27,000 = \$ 177,000[/tex]

Find the equation of the line shown. ​

Answers

Answer:

y = x + 6

Step-by-step explanation:

We can put the equation of the line in slope intercept form [tex]y=mx+b[/tex] where m is the slope and b is the y intercept.

The line passes through (0,6) which means that is our y intercept. Now we have to count the slope. To do this, we can either evaluate the slope given 2 points or count it if given a graph. We have a graph, so the convenient thing to do is to count it. If we count, we see that our slope is [tex]\frac{1}{1}[/tex] or simply 1. All we have to do now is write it in slope intercept form.

[tex]y=x+6[/tex]

11) The Hillmans have $12,000 in a savings
account. The bank pays 1.25% interest on
the savings account, compounded
continuously.
Find the total balance after three years.
A) $12,290.21
C) $11,345.89
B) $12,458.54
D) $11,452.16

Answers

Answer:

To find the total balance after three years, we can use the formula for continuous compounding:

A = Pe^(rt)

Where A is the total balance, P is the principal (initial amount), e is Euler's number (approximately 2.71828), r is the annual interest rate as a decimal, and t is the time in years.

In this case, P = $12,000, r = 0.0125 (1.25% expressed as a decimal), and t = 3. Plugging these values into the formula, we get:

A = $12,000 x e^(0.0125 x 3)

A = $12,000 x e^(0.0375)

A = $12,000 x 1.038163

A = $12,458.54

Therefore, the total balance after three years is $12,458.54.

uhhh yes i need help Each parking spot is eight and one-half feet wide. A parking lot has 24 parking spots side by side. How long is the row of parking spaces in yards?

Answers

The 24 parking spοt length is 68 yards.

What is unit cοnversiοn?

The same feature is expressed in a different unit οf measurement thrοugh a unit cοnversiοn. Time can be stated in minutes rather than hοurs, and distance can be expressed in kilοmetres rather than miles, οr in feet rather than any οther unit οf length.

Here the given width of One parking spot is eight and one-half feet.

Now  we know that 1 feet = [tex]\frac{1}{3}[/tex] yard,

Then , [tex]8\frac{1}{2}[/tex] feet = [tex]\frac{17}{2}[/tex] feet = [tex]\frac{17}{2}\times\frac{1}{3}[/tex] = [tex]2\frac{5}{6}[/tex] yd.

Now Parking lot have 24 parking spot, Then,

=> Total length of parking lοt = 24 [tex]\times[/tex] [tex]2\frac{5}{6}[/tex] = [tex]24\times\frac{17}{6}[/tex] = 68 yard.

Hence The length of parking lοt is 68 yard.

To learn more about unit conversion

https://brainly.com/question/13016491

#SPJ1

Look at the coordinate plane below. T A I N R P K B M O –6 –4 –2 –2 0 –4 2 2 4 4 6 y x Write down the coordinates of the points Write down the letters of the circled points and order them by their second coordinate values, from least to greatest. You will spell a word that describes a way to compare quantities.

Answers

Hence, in response to the provided question, we can say that We discard the t = 0.003 solution since time cannot be negative. As a result, the discus takes around 2.375 seconds to strike the ground.

what is function?

Mathematicians research numbers and their variants, equation and related structures, objects and their locations, and prospective locations for these things. The term "module" is used to describe the connection that exists in between set of inputs, each of which has a corresponding output. A function is an input-output connection in which each inputs results in something like a single, distinct return. A domain, codomain, or scope is assigned to each function. Functions are usually denoted by the letter f. (x). An x is used for entry. On capabilities, one-to-one capabilities, multiple prowess, in capabilities, and on capabilities are the four major types of accessible functions.

The specified function appears to have a typo. I believe it should be:

[tex]h = -16t^2 + 38t + 5[/tex]

a) The discus's initial height can be calculated by entering t = 0 into the function:

[tex]h = -16(0)^2 + 38(0) + 5 = 5[/tex]

As a result, the discus's starting height is 5 feet.

[tex]-16t^2 + 38t + 5 = 0[/tex]

[tex]t = (-b \sqrt(b2 - 4ac)) /[/tex]

t = 0.003 or 2.375

We discard the t = 0.003 solution since time cannot be negative. As a result, the discus takes around 2.375 seconds to strike the ground.

To know more about function visit:

https://brainly.com/question/28193995

#SPJ1

What is the result when 4x - 3 is subtracted from 6x - 9?
(A)-2x - 6
(B)-2x + 6
(C) 2x - 6
(D) 2x + 6
(E) 10x - 12

Answers

Answer: 2x-6

Step-by-step explanation:

Review the information given based on a principal balance of $12,650.00 to answer the question:
FICO Score Simple Interest Rate Total of Payments Total Amount Paid
800-850
12%
29
740-799 15%
33
670-739 18%
38
580-669 21%
300-579 28%
40.0%
48
60
Calculate the percent increase in the amount of interest paid between a household with a 780 credit score and one with a 589 credit score. Round the final answer to the nearest tenth. (4 points)
O 46.1%
39.9%
40.1%
$14,168.00
$14,547.50
$14,927.00
$15,306.50
$16,192.00

Answers

The percent increase in the amount of interest paid between a household with a 780 credit score and one with a 589 credit score is approximately 0.8%, which is closest to option B, 0.8% or 39.9%.

Finding the entire amount paid by each family and comparing the difference in total amount paid will allow us to determine the percentage rise in the amount of interest paid between a household with a credit score of 780 and one with a score of 589.

The overall cost for a FICO score of 780 is:

$12,650 for the principal balance and all installments plus (33 x $60) to get $14,930.

With a 589 FICO score, the total cost is:

Total payments plus principal balance equal $12,650 plus (40 x $60) = $15,050.

The two households' combined total outlays differ in the following ways:

$15,050 - $14,930 = $120

We multiply by 100 and divide the difference by the initial sum to determine the percent increase:

($120 / $14,930) x 100% = 0.802% ≈ 0.8%

In light of this, the difference in interest rates between a family with a 780 credit score and one with a 589 credit score is roughly 0.8%, which is closest to option B, 0.8% or 39.9%.

To know more about Interest Rate visit:

https://brainly.com/question/26122901

#SPJ9

Write an equation parallel to each of the following:

Please help!!!!

Answers

I know the first question answer should be y=2x-4

I don’t know the second question tho

Evaluate:
13-0.75w+8x when w = 12 and x = 1/2

(need help! fast! TmT)

Answers

Answer: To evaluate 13 - 0.75w + 8x when w = 12 and x = 1/2, we substitute these values into the expression:

13 - 0.75w + 8x = 13 - 0.75(12) + 8(1/2)

Simplifying the expression inside the parentheses first:

13 - 9 + 4 = 8

Substituting this value into the expression:

13 - 0.75w + 8x = 13 - 0.75(12) + 8(1/2) = 13 - 9 + 4 = 8 + 4 = 12

Therefore, the value of 13 - 0.75w + 8x when w = 12 and x = 1/2 is 12.

Answer:

8

Step-by-step explanation:

Given expression is
[tex]13-0.75w\:+\:8x[/tex]

and we are asked to evaluate this expression when
[tex]w = 12 ,\: x = \dfrac{1}{2}[/tex]

[tex]0.75w = 0.75 \times 12 = 9[/tex]

[tex]8x = \8 \times \dfrac{1}{2} = 4[/tex]

[tex]\text{So the expression at $w = 12 \; , x= \dfrac{1}{2}$ evaluates to}[/tex]

13 - 9 + 4 = 8

Answer: 8

Prove that Re(z1,z2-bar) = modulus of z1 * modulus of z2 iff arg z1 = arg z2 + 2*pi*n.Use polar form with arg measured in radians​

Answers

Answer:

Step-by-step explanation:

We can start by writing the given equation in terms of polar form:

Re(z1,z2-bar) = modulus of z1 * modulus of z2

If we write z1 and z2 in polar form, we get:

z1 = r1(cosθ1 + i sinθ1)

z2 = r2(cosθ2 + i sinθ2)

Then, the conjugate of z2 is:

z2-bar = r2(cosθ2 - i sinθ2)

Using the formula for the real part of the product of two complex numbers, we get:

Re(z1,z2-bar) = Re(z1 * z2-bar)

Substituting the expressions for z1 and z2-bar, we get:

Re(z1,z2-bar) = Re(r1(cosθ1 + i sinθ1) * r2(cosθ2 - i sinθ2))

Simplifying the product, we get:

Re(z1,z2-bar) = Re(r1r2[(cosθ1 cosθ2 + sinθ1 sinθ2) + i(sinθ1 cosθ2 - cosθ1 sinθ2)])

The real part of this expression is:

Re(z1,z2-bar) = r1r2(cosθ1 cosθ2 + sinθ1 sinθ2)

Using the identity cos(θ1 - θ2) = cosθ1 cosθ2 + sinθ1 sinθ2, we can write:

Re(z1,z2-bar) = r1r2 cos(θ1 - θ2)

Now we can substitute this expression back into the original equation and get:

r1r2 cos(θ1 - θ2) = r1r2

Dividing both sides by r1r2, we get:

cos(θ1 - θ2) = 1

This equation is true if and only if θ1 - θ2 = 2πn for some integer n. In other words, θ1 = θ2 + 2πn, where n is an integer.

Therefore, we have proved that Re(z1,z2-bar) = modulus of z1 * modulus of z2 if and only if arg z1 = arg z2 + 2πn, where n is an integer.

A survey was done with 50 students currently taking Algebra 1 at Laurel Springs School. They were asked which they preferred - English or mathematics? Out of the 50 students, 30 were male. There were 35 students who preferred mathematics and out of those that preferred mathematics, 24 were male. Create a two way relative frequency table for the data. According to the table, would it be safe to assume that females prefer English and males prefer mathematics? Why or why not?

Answers

we can see that a larger proportion of male students preferred mathematics (0.48) compared to female students (0.22), while a larger proportion of female students preferred English (0.18) compared to male students (0.12).

HOW TO SOLVE THE QUESTION?

To create a two-way relative frequency table, we can use the following table:

       | English | Mathematics | Total

--------|---------|-------------|-------

Male    |   x     |     24      |   30

Female  |   y     |     11      |   20

--------|---------|-------------|-------

Total   |   35    |     35      |   50

Here, x and y represent the number of male and female students who preferred English, respectively.

To calculate the values for x and y, we can use the fact that there were 35 students who preferred mathematics, and 24 of them were male. Therefore, the number of females who preferred mathematics is 35 - 24 = 11. Since there are a total of 20 female students, the number of females who preferred English is 20 - 11 = 9. Similarly, the number of male students who preferred English is 30 - 24 = 6.

To calculate the relative frequencies, we can divide each cell by the total number of students (50). For example, the relative frequency of male students who preferred mathematics is 24/50 = 0.48.

The resulting two-way relative frequency table is as follows:

       | English | Mathematics | Total

--------|---------|-------------|-------

Male    |   0.12  |     0.48    |  0.60

Female  |   0.18  |     0.22    |  0.40

--------|---------|-------------|-------

Total   |   0.30  |     0.70    |  1.00

From this table, we can see that a larger proportion of male students preferred mathematics (0.48) compared to female students (0.22), while a larger proportion of female students preferred English (0.18) compared to male students (0.12). However, it would not be safe to assume that all females prefer English and all males prefer mathematics based on this data alone, as there may be individual variations and exceptions to this trend.

It's also important to note that the sample size is relatively small, with only 50 students surveyed, and may not be representative of the larger population. Further research with a larger and more diverse sample size would be needed to make more accurate conclusions about gender-based preferences in this population

To know more about Data visit :-

https://brainly.com/question/27034337

#SPJ1

Find the area of the quadrilateral below.
Give you answer in cm² and give any decimal answers to 1 d.p.

Answers

Answer:

[tex]36 \: cm ^{2} [/tex]

Step-by-step explanation:

triangle area below

[tex] \frac{10 \times 5}{2} = 25[/tex]

EG segment

[tex] \sqrt{10 ^{2} + 5 ^{2} } = \sqrt{125} [/tex]

EF segment

[tex] \sqrt{ (\sqrt{125})^{2} - 2^{2} } = \sqrt{121} [/tex]

triangle area above

[tex] \frac{ \sqrt{121} \times 2}{2} = \sqrt{121} [/tex]

total area

[tex]25 + \sqrt{121} = 36[/tex]

The mean of a sample of 50 claim amounts arising from a certain kind of insurance policy is R4500. Fifteen of these claim amounts have mean R2109 while 14 others have mean R3704. Calculate the mean of the remaining claim amounts in this sample.

Answers

The mean οf the remaining claim is R6739.

What is mean?

The average οf a grοup οf variables is referred tο as the mean in mathematics and statistics. There are several methοds fοr calculating the mean, including simple arithmetic means (adding the numbers tοgether and dividing the result by the number οf οbservatiοns), geοmetric means, and harmοnic means.

Here We knοw that,

Mean = Sum οf amοunts οf claim  / Tοtal number οf claim

Accοrding tο the given,

Mean οf 50 claim οf insurance pοlicy = R 4500 then,

Sum οf amοunt οf 50 claim = 4500*50 = R 225000

Mean οf 15 οf these claim = R 2109 then,

Sum οf amοunt οf 15 claims = 2109*15 = R 31635

Mean οf 14 οther claim = R 3704 then

Sum οf 14 οther claim = 3704*14 = R 51856

Nοw remaining claim amοunt = 50-14-15 = 21

Sum οf 21 remaining claim = 225000-31635-51856 = R 141509

Now Mean = Sum of 21 amount of claim / Total number of claim

=> Mean = 141509/21 = R 6739

Hence the mean of remaining 21 sample is R 6739.

To learn more about mean refer the belοw link

https://brainly.com/question/14532771

#SPJ1

 

in the 3rd quadrant, find SIN

Answers

sin(theta) = rt[1-cos^2 (theta)] = rt15/4
Sign in sin is negative in 3rd quadrant
Thus answer is rt15/4

A manufacturer knows that their items have a normally distributed length, with a mean of 9.8
inches, and standard deviation of 2 inches.
If 17 items are chosen at random, what is the probability that their mean length is less than 10.9
inches?

Answers

As a result, the likelihood that the mean length of a random sample of 17 items is less than 10.9 inches is about 0.9265, or 92.65%.

What exactly is probability?

Probability is a measure of how likely an event is to occur. It is a number between 0 and 1, with 0 suggesting that an occurrence is impossible and 1 indicating that an event is unavoidable. A given event's probability is computed by dividing the number of positive outcomes by the total number of potential possibilities.

In this case, we may utilize the central limit theorem to estimate the sample mean distribution. The central limit theorem states that if the sample size is high enough (n 30), the distribution of the sample mean will be normal.

Regardless of demographic distribution, the population is essentially typical.

In this scenario, the population has a normal distribution with a mean () of 9.8 inches and a standard deviation () of 2 inches. We wish to calculate the likelihood that the sample mean (x) of 17 objects is smaller than 10.9 inches.

The formula for calculating a sample mean's z-score is: z = (x - ) / ( / sqrt(n)), where n is the sample size.

We obtain: z = (10.9 - 9.8) / (2 / sqrt(17)) by substituting the numbers supplied in the problem.

z = 1.45

We may calculate the chance that a standard normal variable is smaller than 1.45 using a typical normal distribution table or calculator:

P(Z < 1.45) = 0.9265

To know more about probability,

https://brainly.com/question/30034780

#SPJ1

Please help!! Correct answer gets brainliest!!

Answers

Answer:

C) 260 square inches.

Step-by-step explanation:

To find the surface area of a pyramid, we can use the formula.

Surface Area = (1/2) x Perimeter of Base x Slant Height + Base Area

where l is the length of one side of the square base, s is the slant height, and Base Area is the area of the square base.

In this case, the base of the pyramid is a square with side length l = 10 inches, so its area is

Base Area = l^2 = 10^2 = 100 square inches

To find the perimeter of the base, we can simply multiply the length of one side by 4

Perimeter of Base = 4l = 4 x 10 = 40 inches

We are also given that the slant height of the pyramid is s = 8 inches.

Now we can substitute the values into the formula.

Surface Area = (1/2) x Perimeter of Base x Slant Height + Base Area

Surface Area = (1/2) x 40 x 8 + 100

Surface Area = 160 + 100

Surface Area = 260 square inches

Therefore, the surface area of the pyramid is 260 square inches.

Answer:360 in

Step-by-step explanation:

Let r(x) = f(g(h(x))), where h(1) = 3, g(3) = 4, h'(1) = 3, g'(3) = 4, and f '(4) = 5. Find r'(1).

Answers

The value of r'(1) = 60 for the given function, using the chain rule.

What are derivatives of composite function?

By adding the derivatives of f(x) with regard to g(x) and g(x) with respect to the variable x, one may get the derivative of the composite function h(x) = f(g(x)). The chain rule of differentiation can be used to derive derivatives of composite functions. Now, let's go over what composite functions are. When a function is expressed in terms of another function, it is said to have a composite function. This suggests that a function can be changed into another function in a composite function.

Using the chain rule of derivatives we have:

r'(x) = f'(g(h(x))) * g'(h(x)) * h'(x)

Substituting the values we have:

r'(1) = f'(g(h(1))) * g'(h(1)) * h'(1)

r'(1) = f'(g(3)) * g'(3) * 3

r'(1) = f'(4) * 4 * 3

r'(1) = 5 * 4 * 3

r'(1) = 60

Hence, the value of r'(1) = 60 for the given function, using the chain rule.

Learn more about composite functions here:

https://brainly.com/question/20379727

#SPJ1

If x is the average of m and 9, y is the average of 2m and 15, and z is the average of 3m and 18, what is the average of x, y, and z in terms of m

Answers

Answer: To find the average of x, y, and z in terms of m, we first need to find expressions for x, y, and z in terms of m:

x = (m + 9)/2

y = (2m + 15)/2

z = (3m + 18)/3 = (m + 6)

To find the average of x, y, and z, we add them up and divide by the number of terms:

average = (x + y + z)/3

Substituting the expressions for x, y, and z, we get:

average = [(m + 9)/2 + (2m + 15)/2 + (m + 6)]/3

Simplifying the expression by combining like terms, we get:

average = (4m + 30)/6

Simplifying further by dividing both the numerator and denominator by 2, we get:

average = (2m + 15)/3

Therefore, the average of x, y, and z in terms of m is (2m + 15)/3.

Step-by-step explanation:

Find s I need help with this IXL question

Answers

Answer:

s = 8 mi

Step-by-step explanation:

We know that the ratio of side lengths of a 30-60-90 triangle is:

short leg : long leg : hypotenuse

     x       :    x√3     :        2x

We can apply this information to the given triangle. We know that the length of the short leg is 4 mi. This can be substituted for x:

x = 4 mi

We are trying to solve for s, which is the triangle's hypotenuse. So, we can apply the ratio to x.

s = 2x = 2(4 mi) = 8 mi

For problems 1 – 6, perform the conversions.
1. 7
16
= % 2. 4
3
5 = __ %
3. Express 55% as a fraction in simplified form: ___
4. Express 248% as a mixed number in simplified form: __
5. 0.00031 = __ % 6. 6.005 = __ %
7. Gigi spent 12% of her birthday money on a new pair of sunglasses. What fraction of her
birthday money did she spend on the new sunglasses?
8. Veronica and her friends went out for pizza to celebrate the volleyball team’s victory.
Their total bill for the pizza and soft drinks was $27.50. They left a 20% tip for their
server. How much tip did they leave?

Answers

Answer:

1. 7/16 = 43.75%

2. 4/5 = 80%

3. 55% = 55/100 = 11/20

4. 248% = 2 48/100 = 2 12/25

5. 0.00031 = 0.031%

6. 6.005 = 600.5%

7. 12% = 12/100 = 3/25 (Gigi spent 3/25 of her birthday money on the new sunglasses)

8. The total bill for pizza and soft drinks was $27.50. With a 20% tip, the amount of tip left would be:

Tip = 20% of total bill

Tip = 20/100 * $27.50

Tip = $5.50

Therefore, Veronica and her friends left a $5.50 tip for their server.

Step-by-step explanation:

Answer:

1. 43.75%

2. 60%

3. 11/20

4. 2 and 12/25

5. 0.031%

6. 600.5%

7. 3/25

8. $5.50

Step-by-step explanation:

1. 7 ÷ 16 = 0.4375

0.4375 x 100 = 43.75%

2. 3 ÷ 5 = 0.6

0.6 x 100 = 60%

3. 55/100

11x25 / 20x5 = 11/20

4.248/100

62x4 / 25x4

62/25

62/25 = 2R12

2 12/25

5. 0.00031 x 100 = 0.031%

6. 6.005 x 100 = 600.5%

7. 12% = 12/100.

12/100 simplified = 3/25

8. $27.50 x 20% = $5.50

A club Ordered two same sized vegetable pizzas cut into different numbers of pieces
what fraction of a whole pizza is left? PLEASE HELP IM GETTING GROUNDED IF YOU DONT HELP IN THE NEXT 24 HOURS!!!!

Answers

Answer:

Without knowing the number of pieces that the pizzas were cut into, it is not possible to determine the fraction of a whole pizza that is left.

Step-by-step explanation:

Tom can paint a fence in 12 hours. Huck can paint the same fence in 10 hours. How long would it take to put two coats of paint on the fence if Tom and Huck work together? Answer as an improper fraction, then round to 1 decimal place. 3) Kim and Josh can clean a house together in 3 hours. If it takes Kim 7 hours to clean the house by herself, how long would it take Josh to clean the house alone? Leave your answer in improper fraction form, then convert to a decimal. 4) Jack can mow the baseball grounds in 2 hours; Mike can mow the same grounds in 3 hours; and Chris can mow the grounds in 4 hours. How long will it take to mow the baseball grounds if Jack, Mike, and Chris work together? Leave your answer in proper fraction form, then round to 1 decimal place. Using your rounded answer, how many minutes would that be?

Answers

2) They tοgether will take 10.9 hours οr 120/11

3) jοsh will take 21/11 hrs οr 1.9 hrs

4) Tοgether they will take 36/13 οr 2.8 hrs

What is decimal place?

The place values οf the digits in a decimal number are displayed οn the decimal place value chart. We knοw that a digit in a number represents a numerical value οr place value.

Decimal place value charts are used tο determine the prοper placement οf each digit in a decimal number.

A decimal number cοnsists οf a whοle number and a fractiοnal cοmpοnent, separated by the decimal pοint, a dοt.

Fοr instance, the decimal number 4.37 has twο parts: an actual number pοrtiοn οf 4 and a fractiοnal pοrtiοn οf 37.

Sοlutiοns tο the abοve prοblem

2) Tοm takes = 12 hrs

Huck takes= 10hrs

We can aply unitary methοd

tοgether they will take= 1/12+1/10=2/t

11t=120;

t=120/11 οr 10.9 hrs

3) Tοgether Kim and jοsh can clean the hοuse tοgether in = 3 hrs

Kim takes = 7hrs

Jοsh will take= 1/7+1/x=2/3

3x+21=14x

21=11x

x=21/11 οr 1.9 hrs

4) Jack makes baseball grοunds in= 2 hrs

Mike takes= 3 hrs

Chris takes= 4 hrs

Tοgether they will take= 1/2+1/3+1/4=3/x

13x=36

x=36/13 οr 2.8 hrs

Learn more about rate

https://brainly.com/question/119866

#SPJ1

What is the volume of the prism?

Enter your answer, as a mixed number in simplest form, in the box.
______________________________________
(reporting wrong/spam answers)
(giving brainliest to the correct answer)
______________________________________

Answers

The cuboidal prism has a volume of 40.625 cubic centimeters

How is area of a cuboid determined?

Multiplying the cuboidal prism's length, width, and height yields its volume. Assuming that the width b and height h are both 2.5 cm and the length l is 6.5 cm. The volume of the cuboidal prism is given by multiplying these dimensions:

V = l b h = 6.5cm x 2.5cm x 2.5cm

 = [tex]40.625cm^3.[/tex]

As a result, the cuboidal prism has a volume of 40.625 cubic centimeters. As a result, the prism can be utilized for a variety of purposes, including packaging, storage, and transportation, and it can accommodate 40.625 cubic centimeters of material inside its boundaries.

Learn more about area and volume here:

brainly.com/question/13789496

#SPJ1

Question 27: Find x

Answers

The angle x opposite to the side measuring 17 is approximately 20.68 degrees using trigonometry.

Let x stand for the side that is the shortest. The Pythagorean theorem yields the following result: x2 + 172 = 19.

When we simplify this equation, we obtain:

[tex]x^2 = 19^2 - 17^2[/tex]

[tex]x^2 = 36x = 6[/tex]

Hence, the shortest side is six inches long.

Using the inverse trigonometric function tangent, we can determine the angle opposite the side measuring 17. (tan).

tan = adjacent/opposite = x/17

By changing the value of x, we obtain:

[tex]tanθ = 6/17[/tex]

We may determine the angle whose tangent is 6/17 using a calculator or a trigonometric table.

[tex]θ = 20.68°[/tex]

As a result, the angle that is opposite the side that measures 17 is roughly 20.68 degrees.

Learn more about x here:

https://brainly.com/question/24225997

#SPJ1

⦁ What is the product of -2^3 + x - 5 and x^3 -3x +4 ?
⦁ Show your work.
⦁ Is the product of -2^3 + x - 5 and x^3 -3x +4 equal to the product of x^3 -3x +4 and -2^3 + x - 5 ? Explain your answer.

Answers

The product of -2³ + x - 5 and x³ -3x +4 is -5x³ + 16x - 28.

How did we get the value?

The given expression is:

-2³ + x - 5 x (x³ -3x +4)

We need to follow the order of operations, which is Parentheses, Exponents, Multiplication and Division (from left to right), and Addition and Subtraction (from left to right).

First, let's simplify -2³, which means -2 x 2 x 2 = -8, so we have:

-8 + x - 5 x (x³ -3x +4)

Next, we need to distribute the -5 to the terms inside the parentheses:

-8 + x - 5x³ + 15x - 20

Now we can combine like terms:

-5x³ + 16x - 28

Therefore, the product of -2³ + x - 5 and x³ -3x +4 is -5x³ + 16x - 28.

Now, to answer the second part of the question, we need to check if:

-2³ + x - 5 x (x³ -3x +4) = (x³ -3x +4) * (-2³ + x - 5)

We can simplify both expressions first:

-8 + x - 5x³ + 15x - 20 = -8 + x - 5x³ + 15x - 20

We can see that both expressions are identical, which means that the product of -2³ + x - 5 and x³ -3x +4 is equal to the product of x³ -3x +4 and -2³ + x - 5, regardless of the order in which we multiply the factors.

learn more about mathematical order of operations: https://brainly.com/question/29626868

#SPJ1

find the critical points and critical values of the function z=x^3+6xy-y^3-1

Answers

Answer:

∂z/∂x = 3x^2 + 6y

∂z/∂y = 6x - 3y^2

Now, we need to solve the system of equations:

3x^2 + 6y = 0

6x - 3y^2 = 0

From the first equation, we get:

y = -x^2/2

Substituting this into the second equation, we get:

6x - 3(-x^2/2)^2 = 0

Simplifying, we get:

6x - 3x^4/4 = 0

Multiplying by 4 and rearranging, we get:

3x^4 - 24x = 0

Factoring out 3x, we get:

3x(x^3 - 8) = 0

Therefore, the critical values of x are x = 0 and x = 2.

For x = 0, we have y = 0 (from y = -x^2/2). So, one critical point is (0, 0).

For x = 2, we have y = -2. So, the other critical point is (2, -2).

To find the critical values of the function, we need to evaluate the function at each critical point:

z(0, 0) = 0^3 + 6(0)(0) - 0^3 - 1 = -1

z(2, -2) = 2^3 + 6(2)(-2) - (-2)^3 - 1 = -13

Therefore, the critical values of the function are -1 and -13.

Astrid says the function being graphed is y=-4+1/3

. She says that her equation is correct because the slope of the line is -4.

Matt says the function that is being graphed is y=1/3x

. He says that the slope of the line is actually 1/3

Is Astrid correct? Is Matt correct? Explain your reasoning

Answers

If Astrid says the function being graphed is y=-4+1/3. Matt is correct, while Astrid is incorrect.

How to find if Matt or Astrid is correct?

Astrid's equation y = -4 + 1/3 is incorrect because it is missing the variable x. The equation is missing a term that represents the x variable, so the equation does not represent a line.

On the other hand, Matt's equation y = 1/3x is correct, and the slope of the line represented by this equation is indeed 1/3. This can be seen from the fact that the equation is in the form y = mx, where m is the slope of the line. In this case, m = 1/3, so Matt is correct.

Therefore, Matt is correct, while Astrid is incorrect.

Learn more about equation here:https://brainly.com/question/2972832

#SPJ1

or Edward opened a savings account and deposited $200.00 as principal. The account earns 9% interest, compounded annually. What is the balance after 5 years?

Answers

The final amount after 5 years is $ 49521.98.  

Compound interest:

Compound interest refers to the interest that is earned on the initial amount of money deposited or borrowed and also on the accumulated interest from previous periods.  

The formula for calculating compound interest is:

                     A = P(1 + r/n)^(nt)

Where

Where:

A = Final amount

P = Principal amount

r = Annual interest rate

n = Number of times the interest is compounded per year

t = Time period

Here we have

The deposited amount, P= $200.00  

Rate of interest, r = 9% = 9/100 = 0.09%

Number of compounds per year, n = 1

Time period, t = 5 years

Using the formula,

A = 2000(1 + 0.09/1)⁽¹⁽⁵⁾⁾

A = 2000(1.09)⁵

A = 49521.98  

Therefore,

The final amount after 5 years is $ 49521.98.  

Learn more about Compound interest at

https://brainly.com/question/29137383

#SPJ1

Assume that when adults with smartphones are randomly​ selected, 44​% use them in meetings or classes. If 7 adult smartphone users are randomly​ selected, find the probability that exactly 5 of them use their smartphones in meetings or classes.

Answers

Answer:

The probability that exactly 5 of the 7 selected smartphone users use their phones in meetings or classes is approximately 0.0127 or 1.27%.

Other Questions
infer the consequence for evolution if speices did not vary (1 point) Assume that the monthly wondwide average number of airplaine crashes of commercial ailines is \( 2.2 \). What is the probability that there wili be (a) at most 3 such accidents in the next m Carlos is creating a 3D newspaper. He wants the text to be readable, but currently the lines are so close together that the bottoms of some letters (like y and p) touch the tops of some capital letters on the following line. What should he adjust to fix this problem?Question 11 options:formattingtrackingtypefacingleading ............................. 1. There are three buses A, B and C. the totalnumber of seats in the three buses is 250. 28% ofthe 250 seat are in bus A.number of seats in bus B:number of seats in busC = 3:238 of the seats in bus B are empty. 26 in bus Care empty.Jamie says the percentage of the seats in bus Bthat are empty is greater than the percentage ofthe seats in bus C that are empty. Is Jamiecorrect. Evaluate the traits of the ancient hero Odysseus. How do these traits influence our modern view of a hero? In an essay, appraise Odysseus's character traits and relate these to the character traits of the modern hero. What traits remain and what traits have changed? Why? PLEASE SHOW WORK!!!!!!!!! A rectangular bathroom tile is 2 and 1/3 times as wide as it is tall . If the tile is 5 cm tall,how wide is isA 3 and 2/3 cmB 7 and 1/3 cm C 10 and 1/3 cm Help me find the answer pls What is the measure of angle H? Explain what is the measure of angle i ? explain What is the molarity of a KCl solution if there are 59.0 grams of KCl dissolved in water to make 2.0 liters of solution? What is relationship between inflation and interest rates? Why must the negative terminals of the batteries be connected on the same side of the parallel circuit and positive terminals on the other side Hull Company reported the following income statement information for the current year:Sales$413,000Cost of goods sold:Beginning inventory$136,500Cost of goods purchased276,000Cost of goods available for sale412,500Ending inventory147,000Cost of goods sold265,500Gross profit$147,500The beginning inventory balance is correct. However, the ending inventory figure was overstated by $23,000.Given this information, calculate gross profit.Cost of Goods SoldCost of Goods Sold or shortly known as CoGS is a term used to refer to the total amount of goods sold to the customers, the amount of which is expressed at their original purchase price for a retail business. a company just paid total dividends of $750,000 and reported additions to retained earnings of $2,250,000. the company has 585,000 shares of stock outstanding and a benchmark p/e ratio of 16 times. what stock price would you consider appropriate? Divide 12a7b2 by 4a2b. 3a5b2 3a5b3 3a5b 3a9b3 who is the group who needs to be a big part of developing a strong program for handling disruptive behavior Is -3 a real irrational rational integer or a whole number Need the steps1. Add a "Total Revenue" column by multiplying the "Billable Hours" column by the "Hourly Rate" column for each year.2. Add a "Total Billable Hours" column by summing up the "Billable Hours" column for each year.3. Add an "Average Hourly Rate" column by dividing the "Total Revenue" column by the "Total Billable Hours" column for each year.4. Sort the table by the "Hourly Rate" column in descending order. Which name is a correct way to name the tiling? Which deal is better. 500ml of lemonade for 94p or 750ml of lemonade for 1.44